Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Biryani Rice Bowl

Layered jasmine rice, fragrant spices, and mixed protein in one skillet — no long braise needed. Golden, aromatic, and done before dinner time.

Total time
20 min
Servings
2
Calories
480
Protein
24g
Biryani Rice Bowl
comfortsatisfyingmalaysianchickenshrimpfluffytenderMain course

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a 12-inch skillet over medium-high heat until shimmering, about 60 seconds.

  2. Step 2

    Cook onion, stirring, until edges begin to turn golden, 2–3 minutes. Scatter the biryani spice over and stir for 30 seconds until fragrant.

  3. Step 3

    Add chicken and shrimp, breaking them apart. Cook without stirring for 90 seconds, then toss and cook until chicken is opaque, 2 minutes total.

  4. Step 4

    Stir in cooked rice, coconut milk, and a pinch of salt. Fold gently until combined and heated through, about 2 minutes.

  5. Step 5

    Pour lime juice over the top. Fold once and taste for seasoning.

  6. Step 6

    Divide into bowls and garnish with fresh cilantro. Serve hot.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.