Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Carrot Fudge Bars

Creamy, fudgy carrot halwa compressed into chewy bars — no oven, no waiting. Cardamom and ghee make it taste like the real thing in a fraction of the time.

Total time
12 min
Servings
4
Calories
420
Protein
6g
10-Min Carrot Fudge Bars
indulgentsimpleindianvegetarianvegetarianchewyfudgydense

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat ghee in a wide skillet over medium. Add grated carrot and stir constantly until it darkens and smells nutty, 6–7 minutes.

  2. Step 2

    Stir in condensed milk, cashews, milk powder, and cardamom seeds. Cook, stirring, until the mixture thickens and pulls from the pan sides, 2–3 minutes.

  3. Step 3

    Pour mixture onto a parchment-lined 8-inch square pan. Press flat with a wet spatula until level.

  4. Step 4

    If using chocolate, scatter chopped pieces over the surface while the halwa is still warm. Let them soften, then spread evenly.

  5. Step 5

    Refrigerate until set, 20–30 minutes. Cut into 12–16 bars. Garnish with coconut if desired.

Tools you’ll need

  • wide skillet or heavy-bottomed pan
  • wooden spoon or silicone spatula
  • 8-inch square baking pan
  • parchment paper
  • knife for cutting

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.