Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Creamy Fettuccine

Silky fettuccine coated in a butter-and-Parmesan sauce that comes together faster than takeout. One skillet, zero cream, pure richness.

Total time
12 min
Servings
2
Calories
582
Protein
22g
Creamy Fettuccine
comfortindulgentitalianvegetariancheesecreamysilkyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil fettuccine in salted water until al dente, about 9 minutes. Reserve 1 cup pasta water, then drain.

  2. Step 2

    Melt butter in the same pot over medium heat. Add garlic and cook 30 seconds until fragrant.

  3. Step 3

    Add drained pasta back to the pot, remove from heat, and toss with Parmesan until coated.

  4. Step 4

    Pour in 3/4 cup pasta water, stirring gently until sauce becomes creamy and silky.

  5. Step 5

    Squeeze lemon juice over the top, season with black pepper, and toss once more.

  6. Step 6

    Serve immediately, adding more pasta water if the sauce tightens as it cools.

Tools you’ll need

  • Large pot
  • Wooden spoon
  • Measuring cups
  • Measuring spoons
  • Microplane or box grater

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.