Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Koshari Bowl

Layered pasta, lentils, and chickpeas topped with crispy onions and tangy tomato sauce. A Cairo street-food classic that comes together in one skillet.

Total time
25 min
Servings
2
Calories
520
Protein
18g
Koshari Bowl
comfortcasualmiddle-easternvegetarianveganlentilschickpeascrispy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil pasta in salted water until al dente, about 8 minutes. Drain and set aside.

  2. Step 2

    Heat 3 tbsp olive oil in a large skillet over medium-high. Add sliced onion and cook, stirring occasionally, until golden and crispy, 6–8 minutes. Transfer to a plate.

  3. Step 3

    In the same skillet, add minced garlic and cook for 30 seconds until fragrant. Add crushed tomatoes, vinegar, and chili powder. Stir and simmer for 3 minutes.

  4. Step 4

    Add lentils and chickpeas to the sauce. Warm through, stirring gently, for 2 minutes. Season with salt and pepper to taste.

  5. Step 5

    Divide cooked pasta between two bowls. Spoon lentil-chickpea mixture over top, then pile crispy onions high on each.

  6. Step 6

    Serve hot with extra vinegar on the side if desired.

Tools you’ll need

  • large pot
  • large skillet (12-inch)
  • colander
  • wooden spoon
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.