Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Minute Zaru Soba

Chilled buckwheat noodles with a punchy dipping sauce of soy, mirin, and dashi. Served with fresh toppings—crispy and refreshing in under 10 minutes.

Total time
10 min
Servings
2
Calories
320
Protein
11g
10-Minute Zaru Soba
lightrefreshingjapanesevegetarianvegetarianchewytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Combine soy sauce, mirin, and dashi in a small bowl. Stir until mirin dissolves. Set aside.

  2. Step 2

    Boil salted water in a large pot. Add soba noodles and cook until just tender, about 4 minutes.

  3. Step 3

    Drain noodles in a fine-mesh strainer and rinse under ice-cold running water until completely chilled.

  4. Step 4

    Slice cucumber into thin matchsticks. If using nori, cut into thin strips.

  5. Step 5

    Divide noodles between two plates or bamboo mats. Top with cucumber and nori.

  6. Step 6

    Pour dipping sauce into two small bowls. Dip noodles into sauce with each bite.

Tools you’ll need

  • large pot
  • fine-mesh strainer
  • small mixing bowl
  • two small dipping bowls
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.