Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Crispy Bacon Quiche

A skillet quiche with bacon, cheese, and eggs that bakes in one pan. Crunchy bacon, melty Gruyère, and a custardy center—weeknight dinner in 15 minutes.

Total time
18 min
Servings
4
Calories
380
Protein
26g
15-Min Crispy Bacon Quiche
comfortindulgentfrenchgluten-freeeggscreamycrispyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Cook bacon in a 10-inch cast iron skillet over medium-high until crispy, about 5 minutes. Transfer to a plate.

  2. Step 2

    Pour off most bacon fat, leaving about 1 tbsp. Add diced onion to the skillet and sauté until softened, 2–3 minutes.

  3. Step 3

    Whisk eggs and cream together in a bowl. Season with salt and pepper. Stir in cooked bacon, cheese, and thyme.

  4. Step 4

    Pour egg mixture into the skillet over the onions. Stir gently to distribute bacon and cheese evenly.

  5. Step 5

    Bake until the center is just set but still slightly jiggly when you shake the pan, 8–10 minutes.

  6. Step 6

    Let cool 2 minutes, then slice into wedges and serve hot from the skillet.

Tools you’ll need

  • 10-inch cast iron skillet
  • small bowl
  • whisk
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.