CookSnap is in beta — Get it free on TestFlight →
Back to recipes

15-Min Meatball Subs

Frozen meatballs + marinara + melted mozzarella on soft bread — done in 15 minutes with zero fuss. The kind of dinner that tastes homemade but takes no skill.

Total time
15 min
Servings
4
Calories
520
Protein
32g
15-Min Meatball Subs
comfortquickamericanbeeftendermeltyweeknightsandwich

Ingredients

  • 16 meatballs frozen meatballs
  • 2 cups marinara sauce
  • 1.5 cups mozzarella cheese, shredded
  • 4 rolls sub rolls or hoagie buns

Instructions

  1. 1

    Heat marinara sauce in a large skillet over medium heat for 2 minutes until simmering.

  2. 2

    Add frozen meatballs directly to the sauce and stir gently to coat, 5 minutes until heated through.

  3. 3

    Slice rolls lengthwise and open them like a book on a baking sheet.

  4. 4

    Spoon meatballs and sauce into each roll, then top generously with mozzarella.

  5. 5

    Broil 2–3 minutes until cheese melts and edges start to brown, watching closely.

  6. 6

    Serve immediately while cheese is still gooey.

Tools you’ll need

  • large skillet
  • baking sheet
  • broiler or oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.