15-Min Meatball Subs
Frozen meatballs + marinara + melted mozzarella on soft bread — done in 15 minutes with zero fuss. The kind of dinner that tastes homemade but takes no skill.
- Total time
- 15 min
- Servings
- 4
- Calories
- 520
- Protein
- 32g

comfortquickamericanbeeftendermeltyweeknightsandwich
Ingredients
- 16 meatballs frozen meatballs
- 2 cups marinara sauce
- 1.5 cups mozzarella cheese, shredded
- 4 rolls sub rolls or hoagie buns
Instructions
- 1
Heat marinara sauce in a large skillet over medium heat for 2 minutes until simmering.
- 2
Add frozen meatballs directly to the sauce and stir gently to coat, 5 minutes until heated through.
- 3
Slice rolls lengthwise and open them like a book on a baking sheet.
- 4
Spoon meatballs and sauce into each roll, then top generously with mozzarella.
- 5
Broil 2–3 minutes until cheese melts and edges start to brown, watching closely.
- 6
Serve immediately while cheese is still gooey.
Tools you’ll need
- large skillet
- baking sheet
- broiler or oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



