Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Meatball Subs

Frozen meatballs + marinara + melted mozzarella on soft bread — done in 15 minutes with zero fuss. The kind of dinner that tastes homemade but takes no skill.

Total time
15 min
Servings
4
Calories
520
Protein
32g
15-Min Meatball Subs
comfortquickamericanbeeftendermeltyweeknightsandwich

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat marinara sauce in a large skillet over medium heat for 2 minutes until simmering.

  2. Step 2

    Add frozen meatballs directly to the sauce and stir gently to coat, 5 minutes until heated through.

  3. Step 3

    Slice rolls lengthwise and open them like a book on a baking sheet.

  4. Step 4

    Spoon meatballs and sauce into each roll, then top generously with mozzarella.

  5. Step 5

    Broil 2–3 minutes until cheese melts and edges start to brown, watching closely.

  6. Step 6

    Serve immediately while cheese is still gooey.

Tools you’ll need

  • large skillet
  • baking sheet
  • broiler or oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.