Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Shoyu Chicken

Sweet-salty Hawaiian-style chicken thighs glazed in soy, brown sugar, and ginger. Crispy-skinned and caramelized in one skillet, served over rice.

Total time
25 min
Servings
4
Calories
520
Protein
42g
Shoyu Chicken
comfortsatisfyinghawaiianchickencrispytenderjuicyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken thighs dry. Season with salt and pepper on both sides.

  2. Step 2

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering. Working in batches, sear thighs skin-side down until golden brown, about 4 minutes per side. Transfer to a plate.

  3. Step 3

    Pour off all but 1 tbsp fat. Add ginger and garlic, stir constantly until fragrant, about 30 seconds.

  4. Step 4

    Whisk together soy sauce, brown sugar, and water. Pour into skillet and bring to a gentle simmer.

  5. Step 5

    Return chicken to skillet skin-side up. Simmer uncovered for 10 minutes, basting thighs with sauce every 2–3 minutes until glaze coats and thickens.

  6. Step 6

    Serve hot over steamed rice, spooning extra sauce over the top.

Tools you’ll need

  • large skillet (12-inch cast iron or stainless steel)
  • tongs
  • whisk
  • instant-read thermometer (optional)
  • serving spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.