Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Rendang Beef

Coconut-rich, spice-forward beef curry that tastes like the real thing—minus the 3-hour simmer. Rendered down in one skillet with a shortcut rendang paste and tender ground beef.

Total time
20 min
Servings
2
Calories
520
Protein
32g
Rendang Beef
comfortboldindonesianbeeftendercreamyweeknightdate-night

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Brown ground beef, breaking it up with a spoon, until no pink remains and it starts to caramelize, about 6 minutes.

  3. Step 3

    Stir in rendang paste until the beef is fully coated and fragrant, about 1 minute.

  4. Step 4

    Pour in coconut milk and bring to a gentle simmer, stirring occasionally, for 8 minutes until the sauce thickens and deepens in color.

  5. Step 5

    Squeeze lime juice over the top and taste, adjusting salt as needed.

  6. Step 6

    Serve over rice, garnished with cilantro and shallots if desired.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.