Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Min Nutella Cookie Bites

Soft, chewy cookie dough bites with melty Nutella centers, zero baking required. Ready in 5 minutes—the easiest TikTok dessert.

Total time
5 min
Servings
12
Calories
165
Protein
2g
5-Min Nutella Cookie Bites
indulgentsimpleitalianvegetarianchewycreamygooeyDessert

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix butter, brown sugar, and vanilla in a bowl until smooth and pale.

  2. Step 2

    Add egg and beat until combined, then fold in flour until no dry streaks remain.

  3. Step 3

    Scoop 1 tbsp dough, flatten on your palm, add 0.5 tsp Nutella in the center.

  4. Step 4

    Fold dough over to seal, roll into a ball, and place on a plate.

  5. Step 5

    Chill in the freezer for 3 minutes until the centers are set and the outside softens.

  6. Step 6

    Serve cold or at room temperature. The dough stays chewy and the Nutella stays gooey.

Tools you’ll need

  • mixing bowl
  • spoon or spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.