Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Aglio e Olio

Silky spaghetti tossed with garlic-infused olive oil, red pepper flakes, and parsley. A 15-minute Roman classic that tastes far more impressive than its ingredient list suggests.

Total time
15 min
Servings
2
Calories
512
Protein
14g
Aglio e Olio
simplefreshelegantitalianvegetarianvegansilkytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large pot. Add spaghetti and cook until al dente, ~9 minutes.

  2. Step 2

    While pasta cooks, heat olive oil in a large skillet over medium. Add garlic slices.

  3. Step 3

    Cook garlic, stirring constantly, until light golden and fragrant, ~2 minutes. Do not brown.

  4. Step 4

    Add red pepper flakes and stir for 10 seconds until the oil smells spicy.

  5. Step 5

    Reserve 1 cup pasta water before draining. Add drained pasta to the skillet with the oil.

  6. Step 6

    Toss pasta with oil over medium heat, adding pasta water 1/4 cup at a time until silky, ~1 minute total.

  7. Step 7

    Season with salt and pepper. Divide between bowls and top with parsley. Serve immediately.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • colander
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.