Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Air Fryer Avocado Fries

Crispy golden avocado wedges with a panko crust, ready in under 10 minutes. Serve with lime crema for a addictive snack that tastes like fried gold.

Total time
8 min
Servings
2
Calories
285
Protein
6g
Air Fryer Avocado Fries
indulgentcasualvegetariancrispycreamysnackappetizersnack

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut avocados in half lengthwise, remove the pit, then cut each half into 3 long wedges.

  2. Step 2

    Beat egg in a shallow bowl. Spread panko in another shallow bowl.

  3. Step 3

    Dip each avocado wedge in egg, then roll in panko to coat all sides evenly.

  4. Step 4

    Place wedges in a single layer in the air fryer basket, skin-side down.

  5. Step 5

    Air fry at 380°F for 5 minutes until the panko is golden and crispy.

  6. Step 6

    Squeeze lime juice over the fries and season with salt and pepper.

  7. Step 7

    Serve immediately while the crust is still crispy.

Tools you’ll need

  • air fryer basket
  • shallow bowls (2)
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.