Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Anago Don

Glazed conger eel over steamed rice with a sweet-savory tare sauce and fresh scallion garnish. A restaurant-quality Japanese classic ready in under 40 minutes.

Total time
35 min
Servings
2
Calories
520
Protein
28g
Anago Don
elegantsatisfyingjapanesefishtendercrispyweeknightdinner

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse rice in a fine strainer under cold water until water runs clear, about 1 minute.

  2. Step 2

    Pat anago dry with paper towels. Cut crosswise into 2-inch-wide rings using kitchen shears or a sharp knife.

  3. Step 3

    In a small bowl, whisk together soy sauce, mirin, sake, and sugar until sugar dissolves.

  4. Step 4

    Combine rice and 1.25 cups water in a medium pot. Bring to a boil over high heat, then cover and reduce to low.

  5. Step 5

    Simmer covered for 18 minutes until water is absorbed and rice is tender. Remove from heat and let sit 5 minutes.

  6. Step 6

    Heat oil in a 10-inch skillet over medium-high until shimmering, about 60 seconds.

  7. Step 7

    Working in batches, pan-fry anago rings 2 minutes per side until the edges curl and flesh is opaque.

  8. Step 8

    Pour the soy-mirin glaze into the skillet. Shake the pan gently for 90 seconds until sauce coats the eel and thickens.

  9. Step 9

    Divide hot rice between two bowls. Top each with anago and sauce, then scatter scallion over the top.

  10. Step 10

    Serve immediately.

Tools you’ll need

  • fine-mesh strainer
  • paper towels
  • kitchen shears or sharp knife
  • small bowl
  • whisk
  • medium pot with lid
  • 10-inch skillet
  • tongs or chopsticks

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.