Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Asam Laksa with Fish & Green Beans

Tangy, aromatic fish noodle soup built on a quick tamarind-and-spice base. Fish, chewy noodles, crisp greens, and a bright punch of sour that hits in under 30 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
32g
25-Min Asam Laksa with Fish & Green Beans
freshbrightsatisfyingmalaysianfishtenderchewyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a pot over medium-high. Add shallots and cook, stirring, until softened and fragrant, about 3 minutes.

  2. Step 2

    Stir in garlic and red chili paste. Cook until fragrant, about 1 minute, then add fish stock and tamarind paste.

  3. Step 3

    Bring broth to a simmer. Cut fish into bite-sized chunks and add to the pot with green beans. Simmer 6–8 minutes until fish flakes easily.

  4. Step 4

    Meanwhile, soften noodles in boiling water, stirring gently, until tender (about 4 minutes if fresh). Drain and divide between bowls.

  5. Step 5

    Ladle broth, fish, and green beans over noodles. Taste and adjust salt or tamarind for balance between sour and salty.

  6. Step 6

    Serve hot, topped with extra sliced shallots and garlic if desired.

Tools you’ll need

  • large pot
  • wooden spoon or ladle
  • cutting board and knife
  • bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.