CookSnap is in beta — Get it free on TestFlight →
Back to recipes

25-Min Asam Laksa with Fish & Green Beans

Tangy, aromatic fish noodle soup built on a quick tamarind-and-spice base. Fish, chewy noodles, crisp greens, and a bright punch of sour that hits in under 30 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
32g
25-Min Asam Laksa with Fish & Green Beans
freshbrightsatisfyingmalaysianfishtenderchewyweeknight

Ingredients

  • 3 tbsp tamarind paste
  • 6 cups fish stock or water
  • 3 medium shallots, thinly sliced
  • 4 clove garlic cloves, minced
  • 14 oz firm white fish fillets (cod, snapper, or halibut)
  • 8 oz fresh rice noodles
  • 6 oz green beans, cut into 2-inch pieces
  • 2 tbsp red chili paste or sambal oelek

Instructions

  1. 1

    Heat oil in a pot over medium-high. Add shallots and cook, stirring, until softened and fragrant, about 3 minutes.

  2. 2

    Stir in garlic and red chili paste. Cook until fragrant, about 1 minute, then add fish stock and tamarind paste.

  3. 3

    Bring broth to a simmer. Cut fish into bite-sized chunks and add to the pot with green beans. Simmer 6–8 minutes until fish flakes easily.

  4. 4

    Meanwhile, soften noodles in boiling water, stirring gently, until tender (about 4 minutes if fresh). Drain and divide between bowls.

  5. 5

    Ladle broth, fish, and green beans over noodles. Taste and adjust salt or tamarind for balance between sour and salty.

  6. 6

    Serve hot, topped with extra sliced shallots and garlic if desired.

Tools you’ll need

  • large pot
  • wooden spoon or ladle
  • cutting board and knife
  • bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.