Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Baked Ziti

Cooked ziti tossed with marinara and mozzarella, then baked until bubbly and golden. A cheesy, comforting pasta casserole that feels homemade in under half an hour.

Total time
25 min
Servings
4
Calories
520
Protein
22g
25-Min Baked Ziti
comfortcasualitalianvegetariancreamymeltytenderweeknight

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil ziti in salted water until al dente, about 9 minutes.

  2. Step 2

    Drain pasta and transfer to a 9x13-inch baking dish.

  3. Step 3

    Pour marinara sauce over pasta and stir until evenly coated.

  4. Step 4

    Top with mozzarella cheese, spreading it in an even layer.

  5. Step 5

    Bake at 400°F until cheese is melted and edges are bubbling, 10–12 minutes.

  6. Step 6

    Let rest 2 minutes, then serve hot.

Tools you’ll need

  • large pot
  • 9x13-inch baking dish
  • oven
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.