25-Min Baked Ziti
Cooked ziti tossed with marinara and mozzarella, then baked until bubbly and golden. A cheesy, comforting pasta casserole that feels homemade in under half an hour.
- Total time
- 25 min
- Servings
- 4
- Calories
- 520
- Protein
- 22g

comfortcasualitalianvegetariancreamymeltytenderweeknight
Ingredients
- 12 oz ziti pasta
- 24 oz marinara sauce
- 2 cups mozzarella cheese, shredded
Instructions
- 1
Boil ziti in salted water until al dente, about 9 minutes.
- 2
Drain pasta and transfer to a 9x13-inch baking dish.
- 3
Pour marinara sauce over pasta and stir until evenly coated.
- 4
Top with mozzarella cheese, spreading it in an even layer.
- 5
Bake at 400°F until cheese is melted and edges are bubbling, 10–12 minutes.
- 6
Let rest 2 minutes, then serve hot.
Tools you’ll need
- large pot
- 9x13-inch baking dish
- oven
- colander
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



