CookSnap is in beta — Get it free on TestFlight →
Back to recipes

25-Min Baked Ziti

Cooked ziti tossed with marinara and mozzarella, then baked until bubbly and golden. A cheesy, comforting pasta casserole that feels homemade in under half an hour.

Total time
25 min
Servings
4
Calories
520
Protein
22g
25-Min Baked Ziti
comfortcasualitalianvegetariancreamymeltytenderweeknight

Ingredients

  • 12 oz ziti pasta
  • 24 oz marinara sauce
  • 2 cups mozzarella cheese, shredded

Instructions

  1. 1

    Boil ziti in salted water until al dente, about 9 minutes.

  2. 2

    Drain pasta and transfer to a 9x13-inch baking dish.

  3. 3

    Pour marinara sauce over pasta and stir until evenly coated.

  4. 4

    Top with mozzarella cheese, spreading it in an even layer.

  5. 5

    Bake at 400°F until cheese is melted and edges are bubbling, 10–12 minutes.

  6. 6

    Let rest 2 minutes, then serve hot.

Tools you’ll need

  • large pot
  • 9x13-inch baking dish
  • oven
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.