CookSnap is in beta — Get it free on TestFlight →
Back to recipes

BBQ Chicken Quesadilla Wedges

Crispy quesadillas stuffed with shredded rotisserie chicken, tangy BBQ sauce, and melted mozzarella. Serve with lime wedges, salsa verde, and hot sauce for dipping.

Total time
12 min
Servings
2
Calories
520
Protein
38g
BBQ Chicken Quesadilla Wedges
casualsatisfyingmexicanchickencrispymeltytenderweeknight

Ingredients

  • 2 cups rotisserie chicken, shredded
  • ½ cup BBQ sauce
  • 4 whole flour tortillas (8-inch)
  • 1.5 cups mozzarella cheese, shredded

Instructions

  1. 1

    Toss shredded chicken with BBQ sauce until evenly coated.

  2. 2

    Place a tortilla in a medium skillet over medium-high heat.

  3. 3

    Spread half the cheese on the tortilla, top with 0.5 cup BBQ chicken, then remaining cheese.

  4. 4

    Lay a second tortilla on top and cook until the bottom is golden and crispy, about 2 minutes.

  5. 5

    Flip and cook the other side until golden and cheese melts through, about 2 minutes.

  6. 6

    Slice into wedges and serve with lime wedges, salsa verde, and hot sauce.

Tools you’ll need

  • medium skillet (10-inch)
  • cutting board
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.