Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

30-Min Beef & Carrot Braise with Mashed Potatoes

Tender beef chunks and carrots braised in red wine and beef broth, finished with creamy mashed potatoes and crispy microgreens. A weeknight take on the French classic that feels restaurant-quality in under 30 minutes.

Total time
30 min
Servings
4
Calories
620
Protein
48g
30-Min Beef & Carrot Braise with Mashed Potatoes
comfortelegantfrenchbeeftendercreamyweeknightdate-night

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil potatoes in salted water until tender, 12–14 minutes. Drain and reserve.

  2. Step 2

    Pat beef dry. Heat 2 tbsp oil in a heavy skillet over medium-high until shimmering.

  3. Step 3

    Brown beef in batches, 2 minutes per side. Transfer to a plate.

  4. Step 4

    Add carrots and thyme to the skillet. Pour in wine and broth, scraping up browned bits.

  5. Step 5

    Return beef to the pan, bring to a simmer, and cook uncovered for 10 minutes until sauce thickens.

  6. Step 6

    Mash potatoes with butter, mustard, salt, and pepper until creamy. Divide among bowls.

  7. Step 7

    Ladle beef and carrots over mashed potatoes. Top with fresh microgreens and thinly sliced radishes.

Tools you’ll need

  • 12-inch heavy skillet or Dutch oven
  • large pot for potatoes
  • wooden spoon
  • tongs
  • slotted spoon
  • potato masher

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.