Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Beef Pastitsada

Tender beef simmered in a rich tomato-wine sauce with cinnamon and cloves, tossed with pasta. A Corfiot classic streamlined for weeknight speed.

Total time
20 min
Servings
2
Calories
542
Protein
38g
20-Min Beef Pastitsada
comfortheartygreekbeeftendercreamyweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large skillet to medium-high. Brown beef in batches, breaking up any clumps, until no pink shows, ~6 minutes total.

  2. Step 2

    Pour in red wine and scrape the pan bottom. Add tomatoes, cinnamon stick, and cloves, then stir.

  3. Step 3

    Reduce heat to medium-low and simmer uncovered until sauce thickens and beef is tender, ~8 minutes.

  4. Step 4

    While sauce simmers, boil pasta in salted water until al dente, then drain and reserve 1/2 cup pasta water.

  5. Step 5

    Toss drained pasta into the sauce. Add pasta water a splash at a time until it reaches a silky consistency.

  6. Step 6

    Season with salt and pepper. Remove cinnamon and cloves. Serve hot.

Tools you’ll need

  • large skillet (12-inch or larger)
  • large pot for pasta
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.