Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Beef Ragù Pappardelle

Ground beef simmered fast with tomato and aromatics, tossed with wide pappardelle pasta. Paired with a bright cherry tomato salad and a glass of red wine for an easy weeknight Italian dinner.

Total time
25 min
Servings
2
Calories
620
Protein
28g
25-Min Beef Ragù Pappardelle
comfortcozyitalianbeeftendercreamyweeknightdinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Dice the onion into small pieces. Heat oil in a large skillet over medium-high heat until shimmering, about 90 seconds.

  2. Step 2

    Add onion to the skillet and cook, stirring, until softened and translucent, about 3 minutes.

  3. Step 3

    Add ground beef to the skillet and brown, breaking it up with a spoon, until no pink remains, about 4 minutes.

  4. Step 4

    Pour in crushed tomatoes with their juice and stir. Simmer for 8 minutes until the sauce thickens and deepens in color.

  5. Step 5

    While the ragù simmers, boil salted water in a separate pot and cook pappardelle until al dente, about 9 minutes.

  6. Step 6

    Drain pasta and toss with ragù. In a bowl, dress arugula and cherry tomatoes with oil, salt, and pepper. Serve ragù alongside the salad.

Tools you’ll need

  • large skillet (12-inch)
  • large pot
  • wooden spoon
  • colander
  • serving bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.