20-Min Beef & Rotini
Ground beef browned straight into marinara, tossed with rotini while hot. Weeknight pasta that tastes like you tried, takes 20 minutes flat.
- Total time
- 20 min
- Servings
- 4
- Calories
- 520
- Protein
- 28g

comfortitalianbeeftenderchewyweeknightpastadinner
Ingredients
- 1 lb ground beef
- 24 oz marinara sauce
- 12 oz rotini pasta
Instructions
- 1
Boil rotini in salted water until al dente, about 9 minutes.
- 2
Brown ground beef in a large skillet over medium-high, breaking it up with a spoon, until no pink remains, about 6 minutes.
- 3
Pour marinara into the skillet with the beef and stir to combine.
- 4
Drain pasta and add it to the skillet, tossing until coated.
- 5
Simmer for 2 minutes so the flavors marry, then serve hot.
Tools you’ll need
- large pot
- large skillet
- wooden spoon
- colander
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



