Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Beef & Rotini

Ground beef browned straight into marinara, tossed with rotini while hot. Weeknight pasta that tastes like you tried, takes 20 minutes flat.

Total time
20 min
Servings
4
Calories
520
Protein
28g
20-Min Beef & Rotini
comfortitalianbeeftenderchewyweeknightpastadinner

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil rotini in salted water until al dente, about 9 minutes.

  2. Step 2

    Brown ground beef in a large skillet over medium-high, breaking it up with a spoon, until no pink remains, about 6 minutes.

  3. Step 3

    Pour marinara into the skillet with the beef and stir to combine.

  4. Step 4

    Drain pasta and add it to the skillet, tossing until coated.

  5. Step 5

    Simmer for 2 minutes so the flavors marry, then serve hot.

Tools you’ll need

  • large pot
  • large skillet
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.