Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Beef Scaloppine with Creamy Mushrooms & Roasted Veg

Thin, golden beef cutlets in a silky mushroom cream sauce, served with a sheet pan of roasted vegetables. Restaurant-worthy in under 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
42g
Beef Scaloppine with Creamy Mushrooms & Roasted Veg
elegantsatisfyingitalianbeeftendercreamycrispyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat beef cutlets dry, season both sides with salt and pepper.

  2. Step 2

    Heat 2 tbsp oil in a 12-inch skillet over medium-high until shimmering, ~90 seconds.

  3. Step 3

    Sear cutlets 90 seconds per side without moving. Remove to a plate.

  4. Step 4

    In the same skillet, sauté mushrooms 3 minutes until golden, stirring occasionally.

  5. Step 5

    Pour in wine, scrape the pan with a wooden spoon for 30 seconds, then stir in cream.

  6. Step 6

    Return cutlets to pan, simmer 2 minutes until sauce coats the back of a spoon.

  7. Step 7

    Squeeze lemon juice over top. Serve scaloppine alongside steamed broccoli and roasted vegetables.

Tools you’ll need

  • 12-inch stainless steel or cast iron skillet
  • wooden spoon
  • cutting board
  • chef's knife
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.