Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Beef Suya Skewers

Smoky, spiced Nigerian beef skewers with a fiery peanut crust. Marinated in aromatics and grilled until charred, served with tangy tomato-onion relish.

Total time
45 min
Servings
4
Calories
420
Protein
42g
Beef Suya Skewers
boldcasualnigerianbeefcharredtendercrispyweeknight

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Soak 8 wooden skewers in cold water for 20 minutes.

  2. Step 2

    Mix ground peanuts, cayenne, paprika, garlic, ginger, 0.5 tsp salt, and black pepper in a shallow bowl.

  3. Step 3

    Pat beef dry. Toss with 1 tbsp oil and a pinch of salt until coated evenly.

  4. Step 4

    Roll beef cubes in peanut mixture, pressing gently so coating adheres. Thread onto skewers, 4–5 pieces per skewer.

  5. Step 5

    Brush skewers with remaining 2 tbsp oil. Let rest 5 minutes.

  6. Step 6

    Toss diced tomato and onion with a pinch of salt and black pepper. Set aside.

  7. Step 7

    Heat grill or grill pan to medium-high (oil the grates lightly). Grill skewers 3–4 minutes, turning once, until edges char and beef cooks through.

  8. Step 8

    Transfer to a serving platter. Let rest 2 minutes.

  9. Step 9

    Spoon tomato relish over skewers. Serve immediately with lime wedges if desired.

Tools you’ll need

  • wooden skewers
  • shallow mixing bowl
  • grill or grill pan
  • long metal tongs
  • small cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.