Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Beijing Jianbing Breakfast Crepe

Crispy-edged Chinese street crepe filled with egg, crumbled tempeh, and scallions, topped with hoisin and chili sauce. Ready in 20 minutes with just one pan.

Total time
20 min
Servings
2
Calories
385
Protein
14g
Beijing Jianbing Breakfast Crepe
casualquickchinesevegetarianeggstempehcrispycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour and water until smooth, no lumps. Let rest 2 minutes.

  2. Step 2

    Crumble tempeh into ¼-inch pieces with your hands.

  3. Step 3

    Heat oil in a 12-inch nonstick skillet over medium-high until shimmering, ~90 seconds.

  4. Step 4

    Pour ½ cup batter into the center; tilt and swirl pan to spread into a thin 8-inch crepe.

  5. Step 5

    Cook until the bottom is light golden and edges curl, ~2 minutes, then flip.

  6. Step 6

    Push crepe to the edge of the pan. Crack 1 egg into the center and scramble lightly with a spatula.

  7. Step 7

    Scatter half the crumbled tempeh and scallions over the egg. Cook until the egg is set, ~1 minute.

  8. Step 8

    Drizzle hoisin and chili oil across the crepe. Fold in half and slide onto a plate.

  9. Step 9

    Repeat steps 4–8 with remaining batter, egg, tempeh, and scallions to make a second crepe.

Tools you’ll need

  • 12-inch nonstick skillet
  • whisk
  • small bowl
  • spatula
  • measuring cups
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.