Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Biryani Bowl with Crispy Chicken & Raita

Fragrant basmati rice layered with spiced fried chicken, creamy raita, and quick dal—all the biryani flavors in one pan, no 90-minute steam required. A complete weeknight dinner that tastes like a celebration.

Total time
20 min
Servings
2
Calories
580
Protein
42g
20-Min Biryani Bowl with Crispy Chicken & Raita
comfortsatisfyingmalaysianindianchickencrispyfluffycreamy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until it shimmers.

  2. Step 2

    Toss diced chicken with 1.5 tbsp biryani spice and a pinch of salt, then add to the skillet.

  3. Step 3

    Cook chicken, stirring occasionally, until golden and cooked through, about 8 minutes.

  4. Step 4

    Stir in cooked rice and dal, warming through for 2 minutes until fragrant.

  5. Step 5

    Mix yogurt with diced cucumber, remaining 0.5 tbsp spice, salt, and cilantro to make raita.

  6. Step 6

    Divide rice bowl between plates, dollop raita on top, and garnish with extra cilantro.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • small bowl (for raita)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.