Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Bratkartoffeln

Crispy German pan-fried potatoes with onions and bacon, finished with fresh parsley. A rustic, one-pan side or light main that comes together in under 40 minutes.

Total time
35 min
Servings
4
Calories
385
Protein
14g
Bratkartoffeln
comfortrusticgermaneggscrispytenderweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 3/4-inch cubes. Place in a pot of cold salted water.

  2. Step 2

    Bring to a boil, then reduce heat. Simmer 8–10 minutes until just tender but still holding shape.

  3. Step 3

    Drain potatoes well in a colander. Spread on a clean kitchen towel to cool and dry.

  4. Step 4

    In a 12-inch skillet over medium-high, cook bacon until crispy, 5–6 minutes. Transfer to a plate.

  5. Step 5

    Add onion to the bacon fat. Cook, stirring occasionally, until golden and soft, 4–5 minutes.

  6. Step 6

    Add garlic and stir until fragrant, about 30 seconds.

  7. Step 7

    Add dried potatoes to the skillet in a single layer. Do not stir for 3 minutes—let them brown.

  8. Step 8

    Stir and spread into an even layer again. Cook until golden and crispy, 4–5 minutes more.

  9. Step 9

    Taste and season with salt and pepper. Return bacon to the skillet and toss gently to combine.

  10. Step 10

    Transfer to a serving dish. Garnish with fresh parsley and serve immediately.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • colander
  • kitchen towel
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.