Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Buddha Jumps Over Broth

A streamlined weeknight version of the legendary Chinese stew: chicken, shrimp, and mushrooms braised in a deeply savory ginger-soy broth with just enough time to build real flavor. Served bubbling hot over rice.

Total time
25 min
Servings
4
Calories
320
Protein
42g
Buddha Jumps Over Broth
heartycomfortchinesechickenshrimptendersilkyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring stock to a gentle boil in a large pot over medium-high heat.

  2. Step 2

    Add soy sauce, ginger slices, and dried mushrooms if using. Simmer 3 minutes until fragrant.

  3. Step 3

    Add chicken pieces, fresh shiitake, and shrimp. Stir gently to submerge.

  4. Step 4

    Simmer uncovered for 8–10 minutes until chicken is opaque and shrimp turns pink.

  5. Step 5

    Stir in scallions. Taste and adjust salt or soy sauce if needed.

  6. Step 6

    Ladle into bowls over steamed rice. Serve immediately while the broth is still steaming.

Tools you’ll need

  • large pot (4-quart or larger)
  • wooden spoon or ladle
  • knife for slicing
  • bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.