Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Bun Cha Ca — Vietnamese Fish Cake Noodle Soup

Tangy, brothy bowl of rice noodles topped with crispy fish cakes and fresh herbs. A TikTok-easy take on the Hanoi classic—no long simmering, just bright flavors in 20 minutes.

Total time
20 min
Servings
2
Calories
385
Protein
18g
20-Min Bun Cha Ca — Vietnamese Fish Cake Noodle Soup
freshlightquickvietnamesefishcrispytenderchewy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring water to a boil in a large pot over high heat, ~4 minutes.

  2. Step 2

    While water heats, cut fish cakes into bite-size pieces. Pat with a paper towel to remove excess moisture.

  3. Step 3

    Add rice noodles to boiling water, stir gently, and cook until tender, ~4 minutes. Drain and divide between two bowls.

  4. Step 4

    Heat oil in a skillet over medium-high. Pan-fry fish cakes until edges are golden and crispy, ~5 minutes, stirring occasionally.

  5. Step 5

    Stir fish sauce into the hot cooking water and pour over noodles. Top with crispy fish cakes and fresh herbs.

  6. Step 6

    Squeeze lime wedge over each bowl. Serve chili paste on the side for stirring in.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • wooden spoon
  • tongs or slotted spoon
  • two serving bowls
  • paper towels
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.