Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Buttery Sage Tortelli di Zucca

Fresh cheese-and-pumpkin filled tortelli tossed in brown butter and crispy sage. If fresh tortelli aren't available, frozen works perfectly and needs no thawing.

Total time
25 min
Servings
2
Calories
520
Protein
18g
Buttery Sage Tortelli di Zucca
elegantcomfortitalianvegetariancheesetendercreamyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of salted water to a rolling boil over high heat.

  2. Step 2

    Add tortelli and cook until they float and have been at a rolling boil for 2–3 minutes more. Taste for tenderness — they should yield slightly when pressed.

  3. Step 3

    While tortelli cook, melt butter in a large skillet over medium heat. Add sage leaves and let them crisp and release fragrance, about 2 minutes.

  4. Step 4

    Scoop tortelli directly from the pot into the butter-sage skillet using a slotted spoon. Toss gently to coat, adding a splash of pasta water if needed.

  5. Step 5

    Divide between bowls. Shower with grated parmesan, a squeeze of lemon juice, and toasted pine nuts. Finish with a grind of black pepper.

Tools you’ll need

  • large pot (5-quart minimum)
  • large skillet (12-inch)
  • slotted spoon
  • microplane or box grater
  • large bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.