Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Café-Quality Cappuccino at Home

Espresso shots topped with velvety steamed milk and a thin layer of microfoam — the classic Italian ratio that tastes like your favorite coffee shop. Takes 5 minutes, no fancy equipment required.

Total time
5 min
Servings
1
Calories
95
Protein
7g
Café-Quality Cappuccino at Home
cozyelegantitalianvegetariancreamysilkyweeknightbrunch

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pull two shots of espresso (2 oz total) into a warm 8–10 oz ceramic cup.

  2. Step 2

    Pour cold milk into a small pitcher. Add sugar and a pinch of salt.

  3. Step 3

    Steam or froth the milk using an espresso machine wand until it reaches 150–155°F and a thin layer of microfoam forms on top.

  4. Step 4

    Pour the steamed milk into the espresso, holding back the foam with a spoon. Top with a thin cap of microfoam.

  5. Step 5

    Serve immediately while the drink is still hot.

Tools you’ll need

  • espresso machine with steam wand
  • 8–10 oz ceramic cup
  • small milk pitcher (12 oz)
  • kitchen thermometer (optional but recommended)
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.