Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Min Cajun Chicken Alfredo

Creamy cajun pasta with seared chicken, garlic, and a spicy kick — ready in under 10 minutes using store-bought alfredo as the base. One skillet, bold flavor, zero fuss.

Total time
15 min
Servings
2
Calories
625
Protein
38g
15-Min Cajun Chicken Alfredo
comfortquickcajunchickencreamytenderweeknightpasta

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet, add pasta, and cook until al dente, ~8 minutes.

  2. Step 2

    Reserve 1 cup pasta water, then drain the pasta. Do not rinse.

  3. Step 3

    Return skillet to medium-high heat. Add chicken and cajun seasoning; sear until no pink remains, ~5 minutes, stirring often.

  4. Step 4

    Add minced garlic and red pepper flakes; cook until fragrant, ~30 seconds.

  5. Step 5

    Pour in alfredo sauce and return cooked pasta to the skillet. Toss until coated; add pasta water a splash at a time if too thick.

  6. Step 6

    Taste and adjust seasoning. Serve hot.

Tools you’ll need

  • large skillet with lid
  • wooden spoon
  • colander or fine strainer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.