Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cajun Shrimp Boil

Shrimp, smoked sausage, and potatoes tossed with butter and Cajun spice in one skillet. No boiling pot, no draining—just dump, sear, and eat straight from the pan.

Total time
15 min
Servings
2
Calories
520
Protein
48g
Cajun Shrimp Boil
casualsatisfyingcajunshrimptendercrispyweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice potatoes into 1/4-inch rounds. You want thin so they cook fast.

  2. Step 2

    Melt butter in a large skillet over medium-high heat until it foams, about 90 seconds.

  3. Step 3

    Add potatoes and sausage. Stir and cook until potatoes are fork-tender, 8–10 minutes.

  4. Step 4

    Push potatoes and sausage to the sides. Add shrimp and Cajun seasoning to the center of the skillet.

  5. Step 5

    Toss everything together. Cook 2–3 minutes until shrimp are opaque and pink, not translucent.

  6. Step 6

    Squeeze lemon over the top. Serve straight from the skillet with crusty bread.

Tools you’ll need

  • 12-inch skillet with high sides (cast iron preferred)
  • cutting board
  • chef's knife
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.