Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cantonese Shrimp Toast

Crispy fried bread topped with a savory shrimp paste—a dim sum classic. Pan-fried until golden, these handheld bites deliver umami depth and textural contrast in under 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
12g
Cantonese Shrimp Toast
casualsimplechineseshrimpcrispytenderweeknightparty

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the shrimp dry with paper towels and place them on a cutting board.

  2. Step 2

    Chop the shrimp into small pieces about the size of peas, then transfer to a small bowl.

  3. Step 3

    Add the egg white, cornstarch, soy sauce, sesame oil, salt, and white pepper to the shrimp and stir until the mixture looks evenly combined and slightly sticky.

  4. Step 4

    Lay each bread slice flat on a cutting board and spread 1 tablespoon of shrimp paste in an even layer across the entire surface, leaving no gaps.

  5. Step 5

    Pour the neutral oil into a 10-inch skillet and heat over medium-high heat until it shimmers and a bread cube sizzles immediately when dropped in, about 2 minutes.

  6. Step 6

    Working in batches of 3–4 slices, carefully place each bread slice shrimp-side down into the hot oil using a spatula or tongs.

  7. Step 7

    Fry for 2–3 minutes until the shrimp paste turns light tan and the bread underneath becomes golden brown, watching for sizzle.

  8. Step 8

    Using a slotted spatula, flip each toast carefully and fry the bread side for another 1–2 minutes until it turns the color of warm honey.

  9. Step 9

    Transfer the finished toast to a paper towel-lined plate to drain excess oil, then repeat with remaining bread slices.

  10. Step 10

    Arrange the warm shrimp toast on a serving plate with the shrimp side facing up, and serve immediately while crispy.

Tools you’ll need

  • cutting board
  • paper towels
  • small bowl
  • wooden spoon
  • 10-inch skillet
  • instant-read thermometer or wooden chopstick for oil test
  • spatula or slotted turner
  • tongs
  • paper towel-lined plate
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.