Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Caramelized Chicken & Shrimp Stew

Vietnamese-style mixed protein stew with chicken thighs and shrimp braised in caramel, fish sauce, and aromatics. A two-protein showstopper that feels fancy but comes together in one pot.

Total time
22 min
Servings
4
Calories
285
Protein
38g
20-Min Caramelized Chicken & Shrimp Stew
comfortsatisfyingvietnamesechickenshrimptenderjuicyMain course

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut chicken thighs into 2-inch pieces. Pat dry with paper towels.

  2. Step 2

    Heat 1 tbsp oil in a heavy pot over medium-high. Add sugar and cook, swirling occasionally, until deep amber, ~3 minutes.

  3. Step 3

    Add chicken pieces. Stir to coat in caramel for 2 minutes without letting sugar burn.

  4. Step 4

    Pour in fish sauce (caramel will bubble). Add onion, ginger, and scallion whites. Bring to a boil, then lower to medium.

  5. Step 5

    Simmer 8 minutes until chicken is cooked through. Stir in shrimp and scallion greens.

  6. Step 6

    Cook 2 minutes more until shrimp are pink and cooked through. Taste and adjust salt if needed.

Tools you’ll need

  • Large heavy pot or Dutch oven
  • Knife and cutting board
  • Paper towels
  • Wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.