Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Caramelized Fish with Rice & Greens

Crispy-edged fish braised in a sweet-salty caramel sauce with bitter melon beef and fresh greens on the side. A complete Vietnamese weeknight dinner in one skillet.

Total time
20 min
Servings
2
Calories
385
Protein
38g
20-Min Caramelized Fish with Rice & Greens
comfortsatisfyingvietnamesefishcrispytenderjuicyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Add sugar and stir until it dissolves and turns golden, about 2 minutes — watch it carefully.

  3. Step 3

    Pour in fish sauce, then slide the fish fillets into the skillet without stirring them.

  4. Step 4

    Cook for 6–7 minutes without moving; the edges should look opaque and caramelized on the bottom.

  5. Step 5

    Warm the cooked beef mixture in a small bowl or on the side of the skillet while the fish finishes.

  6. Step 6

    Serve the fish with rice, warmed beef, fresh greens, and a drizzle of pan sauce on top.

Tools you’ll need

  • 12-inch skillet with lid
  • small bowl
  • wooden spoon
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.