Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Cashew Chicken with Glossy Sauce

Tender chicken and roasted cashews coated in a sweet-salty soy glaze with a whisper of ginger. Ready in one skillet, perfect for weeknight dinner.

Total time
18 min
Servings
2
Calories
510
Protein
42g
20-Min Cashew Chicken with Glossy Sauce
satisfyingquickchinesechickentendercrispyweeknightmain-dish

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp neutral oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Add chicken pieces and cook without stirring for 2 minutes, then stir and brown for 3 more minutes until mostly opaque.

  3. Step 3

    Stir in ginger and cook for 30 seconds until fragrant.

  4. Step 4

    Pour soy sauce and honey into the skillet, then stir in cashews and toss until the sauce coats everything and turns glossy, about 2 minutes.

  5. Step 5

    Scatter scallions over the top and toss once more.

  6. Step 6

    Serve immediately over rice or noodles if desired.

Tools you’ll need

  • large skillet (12-inch)
  • cutting board
  • chef's knife
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.