Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cast-Iron Steak Fajitas with Rice & Beans

Sizzling strips of seasoned beef with charred peppers and onions, served over Mexican rice and refried beans. A complete weeknight dinner cooked entirely in one skillet.

Total time
28 min
Servings
2
Calories
680
Protein
48g
Cast-Iron Steak Fajitas with Rice & Beans
satisfyingcasualmexicanbeeftendercrispyweeknightdinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat steak dry with paper towels. Season generously with salt, pepper, and the spice mix on both sides.

  2. Step 2

    Heat 2 tbsp oil in a 12-inch cast-iron skillet over high heat until it shimmers, about 90 seconds.

  3. Step 3

    Sear steak 2 minutes per side without moving. Center should still be pink; transfer to a cutting board to rest.

  4. Step 4

    Add peppers and onions to the skillet. Stir-fry until charred at the edges and tender, about 5 minutes.

  5. Step 5

    Warm the rice and beans in a small pot or microwave while the vegetables cook. Warm tortillas on the stove.

  6. Step 6

    Slice the rested steak against the grain into thin strips. Return to the skillet with the vegetables and toss.

  7. Step 7

    Squeeze lime over the top. Serve the steak and vegetables alongside rice, beans, and warm tortillas.

Tools you’ll need

  • 12-inch cast-iron skillet
  • cutting board
  • sharp knife
  • paper towels
  • small pot or microwave (for rice and beans)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.