CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Cast-Iron Steak Fajitas with Rice & Beans

Sizzling strips of seasoned beef with charred peppers and onions, served over Mexican rice and refried beans. A complete weeknight dinner cooked entirely in one skillet.

Total time
28 min
Servings
2
Calories
680
Protein
48g
Cast-Iron Steak Fajitas with Rice & Beans
satisfyingcasualmexicanbeeftendercrispyweeknightdinner

Ingredients

  • 1 lb flank or skirt steak
  • 2 large bell peppers (red, yellow, or orange), sliced into strips
  • 1 large yellow onion, sliced into strips
  • 2 tsp cumin, chili powder, and paprika (mixed)
  • 1 whole lime
  • 1.5 cups cooked Mexican rice
  • 1 cup refried beans (canned or prepared)
  • 8 count flour or corn tortillas

Instructions

  1. 1

    Pat steak dry with paper towels. Season generously with salt, pepper, and the spice mix on both sides.

  2. 2

    Heat 2 tbsp oil in a 12-inch cast-iron skillet over high heat until it shimmers, about 90 seconds.

  3. 3

    Sear steak 2 minutes per side without moving. Center should still be pink; transfer to a cutting board to rest.

  4. 4

    Add peppers and onions to the skillet. Stir-fry until charred at the edges and tender, about 5 minutes.

  5. 5

    Warm the rice and beans in a small pot or microwave while the vegetables cook. Warm tortillas on the stove.

  6. 6

    Slice the rested steak against the grain into thin strips. Return to the skillet with the vegetables and toss.

  7. 7

    Squeeze lime over the top. Serve the steak and vegetables alongside rice, beans, and warm tortillas.

Tools you’ll need

  • 12-inch cast-iron skillet
  • cutting board
  • sharp knife
  • paper towels
  • small pot or microwave (for rice and beans)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.