Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Champ & Herb-Crusted Fish with Lime

Creamy mashed potatoes loaded with scallions, served alongside a quick pan-seared fish fillet with fresh herb crust and bright lime. A restaurant-quality Irish dinner in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
38g
Champ & Herb-Crusted Fish with Lime
elegantsimpleirishfishcreamycrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut potatoes into 1-inch chunks. Boil in salted water until fork-tender, ~12 minutes.

  2. Step 2

    While potatoes cook, pat fish dry and season both sides generously with salt and black pepper.

  3. Step 3

    Drain potatoes and return to pot. Mash with butter and warm milk until creamy, then fold in scallions.

  4. Step 4

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering, ~90 seconds.

  5. Step 5

    Sear fish 3 minutes per side without moving. Sprinkle fresh herbs on top during the last 30 seconds.

  6. Step 6

    Divide champ between two plates, top with fish, and serve with lime wedges for squeezing.

Tools you’ll need

  • large pot
  • wooden spoon or potato masher
  • 12-inch skillet
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.