Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Charred Veggie Tacos

Bell peppers and zucchini hit a hot skillet until blistered and tender, then tucked into warm tortillas with salsa and avocado. Ready in under 10 minutes.

Total time
10 min
Servings
2
Calories
285
Protein
8g
10-Min Charred Veggie Tacos
quickcasualmexicanvegetarianvegancrispytenderweeknight

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice bell pepper into 1/2-inch strips and chop zucchini into half-moons.

  2. Step 2

    Heat oil in a skillet over medium-high until shimmering, about 90 seconds.

  3. Step 3

    Add peppers and zucchini, cook without stirring for 2 minutes until edges char.

  4. Step 4

    Stir and cook 2 more minutes until tender with some blackened spots.

  5. Step 5

    Warm tortillas in the skillet 15 seconds per side.

  6. Step 6

    Fill tortillas with charred veggies, salsa, and sliced avocado; serve hot.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.