Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Chee Cheong Fun with Sweet Soy Glaze

Silky steamed rice rolls topped with a glossy sweet-salty soy glaze, shrimp, and fresh scallions. Zero rolling required — buy pre-made rolls and finish in one skillet.

Total time
20 min
Servings
2
Calories
340
Protein
18g
20-Min Chee Cheong Fun with Sweet Soy Glaze
comfortquickmalaysianshrimpsilkytenderweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk soy sauce, sesame oil, and sugar in a small bowl until sugar dissolves.

  2. Step 2

    Heat neutral oil in a 12-inch skillet over medium-high until shimmering, about 90 seconds.

  3. Step 3

    Add shrimp to the skillet and cook, stirring occasionally, until pink and cooked through, 3–4 minutes.

  4. Step 4

    Gently add rice roll sheets and fold them into the shrimp without breaking, 2 minutes.

  5. Step 5

    Pour the soy glaze over everything and toss gently until coated, coating should look glossy.

  6. Step 6

    Slide onto a plate, top with sliced scallions, and serve immediately.

Tools you’ll need

  • small mixing bowl
  • 12-inch skillet
  • tongs or silicone spatula
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.