CookSnap is in beta — Get it free on TestFlight →
Back to recipes

25-Min Cheesy Beef & Rice Bake

Ground beef browned with rice and cream soup, baked until bubbly with melted cheddar on top. Serve alongside a fresh salad and sliced cucumbers for a complete weeknight dinner.

Total time
25 min
Servings
4
Calories
520
Protein
32g
25-Min Cheesy Beef & Rice Bake
comfortamericanbeefcreamytenderweeknightcasseroledinner

Ingredients

  • 1 lb ground beef
  • 1 cup rice (uncooked)
  • 1 can (10.5 oz) cream soup (condensed, like cream of mushroom or celery)
  • 1 cup cheddar cheese, shredded

Instructions

  1. 1

    Heat oil in a 10-inch oven-safe skillet over medium-high heat until shimmering.

  2. 2

    Brown ground beef, breaking it up with a spoon, until no pink remains, about 6 minutes.

  3. 3

    Stir in uncooked rice and cream soup, then add 1.5 cups water and a pinch of salt.

  4. 4

    Bring to a simmer, then cover and transfer to a 375°F oven for 12 minutes.

  5. 5

    Remove from oven, scatter cheddar over the top, and bake uncovered for 2 more minutes until melted.

  6. 6

    Serve hot with green salad and sliced cucumbers on the side.

Tools you’ll need

  • 10-inch oven-safe skillet
  • wooden spoon
  • measuring cup
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.