Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Cheesy Beef & Rice Bake

Ground beef browned with rice and cream soup, baked until bubbly with melted cheddar on top. Serve alongside a fresh salad and sliced cucumbers for a complete weeknight dinner.

Total time
25 min
Servings
4
Calories
520
Protein
32g
25-Min Cheesy Beef & Rice Bake
comfortamericanbeefcreamytenderweeknightcasseroledinner

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a 10-inch oven-safe skillet over medium-high heat until shimmering.

  2. Step 2

    Brown ground beef, breaking it up with a spoon, until no pink remains, about 6 minutes.

  3. Step 3

    Stir in uncooked rice and cream soup, then add 1.5 cups water and a pinch of salt.

  4. Step 4

    Bring to a simmer, then cover and transfer to a 375°F oven for 12 minutes.

  5. Step 5

    Remove from oven, scatter cheddar over the top, and bake uncovered for 2 more minutes until melted.

  6. Step 6

    Serve hot with green salad and sliced cucumbers on the side.

Tools you’ll need

  • 10-inch oven-safe skillet
  • wooden spoon
  • measuring cup
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.