Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Beef Tater Tot Casserole

Ground beef and cream soup layer bakes with melty cheese and crispy tater tots on top—done in 25 minutes. Serve with roasted vegetables for a complete weeknight dinner.

Total time
25 min
Servings
4
Calories
612
Protein
32g
Cheesy Beef Tater Tot Casserole
comfortamericanbeefcrispycreamymeltyweeknightcasserole

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 375°F and preheat a 9x13-inch baking dish.

  2. Step 2

    Brown ground beef in a skillet over medium-high heat, breaking it up as it cooks, until no pink remains (~6 minutes).

  3. Step 3

    Stir in cream soup and 1 cup of cheese, then pour the mixture into the baking dish.

  4. Step 4

    Spread frozen tater tots in an even layer over the beef mixture.

  5. Step 5

    Sprinkle remaining 0.5 cup cheese over the tater tots, then bake until tots are golden, ~15 minutes.

  6. Step 6

    Serve hot alongside roasted brussels sprouts or steamed cauliflower.

Tools you’ll need

  • 9x13-inch baking dish
  • 12-inch skillet
  • wooden spoon
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.