Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Corn Empanadas

Golden-fried corn-and-cheese hand pies bursting with fresh corn, scallions, and a touch of chili heat. Argentine humita meets weeknight dinner.

Total time
25 min
Servings
4
Calories
385
Protein
9g
Cheesy Corn Empanadas
comfortcasualargentinianvegetariancheesecrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Thaw corn and blot dry with paper towels. Stir corn, flour, cheese, scallions, egg, a pinch of salt, pepper, and ají (if using) until a rough dough forms.

  2. Step 2

    Wet your hands lightly. Scoop 2 tbsp dough, flatten into a 3-inch disc, fold in half, press edges to seal. Repeat to make 8 empanadas.

  3. Step 3

    Heat oil in a large skillet over medium-high until a pinch of dough sizzles on contact, about 2 minutes.

  4. Step 4

    Fry empanadas in two batches 2 minutes per side until golden brown and crispy. Transfer to paper towels.

  5. Step 5

    Serve warm with additional ají or a dollop of sour cream for dipping.

Tools you’ll need

  • large skillet
  • paper towels
  • mixing bowl
  • slotted spoon or spider

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.