Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cheesy Garlic Crescent Bites

Flaky crescent rolls stuffed with melty mozzarella and garlic powder, baked until golden in under 15 minutes. Crispy outside, gooey inside — perfect grab-and-go snack.

Total time
12 min
Servings
2
Calories
210
Protein
8g
Cheesy Garlic Crescent Bites
quickcasualamericanvegetariancrispyflakygooeyweeknight

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Unroll crescent dough and separate into 8 triangles along perforations.

  2. Step 2

    Sprinkle mozzarella and garlic powder onto the wide end of each triangle.

  3. Step 3

    Roll each triangle tightly from the wide end toward the point to enclose filling.

  4. Step 4

    Place on an ungreased baking sheet and bake at 375°F until golden, about 10–12 minutes.

  5. Step 5

    Cool 1 minute, then serve warm.

Tools you’ll need

  • baking sheet
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.