Cheesy Garlic Crescent Bites
Flaky crescent rolls stuffed with melty mozzarella and garlic powder, baked until golden in under 15 minutes. Crispy outside, gooey inside — perfect grab-and-go snack.
- Total time
- 12 min
- Servings
- 2
- Calories
- 210
- Protein
- 8g

quickcasualamericanvegetariancrispyflakygooeyweeknight
Ingredients
- 1 tube (8 oz) refrigerated crescent roll dough
- ¾ cup mozzarella cheese, shredded
- ½ tsp garlic powder
Instructions
- 1
Unroll crescent dough and separate into 8 triangles along perforations.
- 2
Sprinkle mozzarella and garlic powder onto the wide end of each triangle.
- 3
Roll each triangle tightly from the wide end toward the point to enclose filling.
- 4
Place on an ungreased baking sheet and bake at 375°F until golden, about 10–12 minutes.
- 5
Cool 1 minute, then serve warm.
Tools you’ll need
- baking sheet
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



