Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Cheesy Polenta Taragna

Creamy polenta with buckwheat flour and melted cheese, finished under the broiler until golden. A Lombardy classic made fast—nutty, savory, deeply comforting.

Total time
20 min
Servings
2
Calories
485
Protein
18g
20-Min Cheesy Polenta Taragna
comfortcozyitalianvegetariancheesecreamymeltyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat milk and broth in a large skillet over medium-high until it steams, ~3 minutes.

  2. Step 2

    Whisk polenta and buckwheat flour into a small bowl with 0.5 cup cold water until smooth.

  3. Step 3

    Pour the polenta mixture slowly into the hot liquid while whisking constantly to prevent lumps.

  4. Step 4

    Reduce heat to medium-low and stir continuously for 8–10 minutes until polenta pulls away from the pan's sides.

  5. Step 5

    Stir in cheese and butter until melted and glossy. Season with salt and pepper to taste.

  6. Step 6

    Transfer to a broiler-safe skillet or baking dish, smooth the top, and broil 3–4 inches from heat until golden brown, ~4 minutes.

Tools you’ll need

  • large skillet (12-inch)
  • small bowl
  • whisk
  • wooden spoon
  • broiler-safe skillet or baking dish
  • broiler

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.