CookSnap is in beta — Get it free on TestFlight →
Back to recipes

20-Min Cheesy Polenta Taragna

Creamy polenta with buckwheat flour and melted cheese, finished under the broiler until golden. A Lombardy classic made fast—nutty, savory, deeply comforting.

Total time
20 min
Servings
2
Calories
485
Protein
18g
20-Min Cheesy Polenta Taragna
comfortcozyitalianvegetariancheesecreamymeltyweeknight

Ingredients

  • 2 cups whole milk
  • 1 cup vegetable broth
  • ¾ cup polenta (cornmeal)
  • ¼ cup buckwheat flour
  • 1 cup fontina or gruyère cheese, shredded
  • 3 tbsp butter

Instructions

  1. 1

    Heat milk and broth in a large skillet over medium-high until it steams, ~3 minutes.

  2. 2

    Whisk polenta and buckwheat flour into a small bowl with 0.5 cup cold water until smooth.

  3. 3

    Pour the polenta mixture slowly into the hot liquid while whisking constantly to prevent lumps.

  4. 4

    Reduce heat to medium-low and stir continuously for 8–10 minutes until polenta pulls away from the pan's sides.

  5. 5

    Stir in cheese and butter until melted and glossy. Season with salt and pepper to taste.

  6. 6

    Transfer to a broiler-safe skillet or baking dish, smooth the top, and broil 3–4 inches from heat until golden brown, ~4 minutes.

Tools you’ll need

  • large skillet (12-inch)
  • small bowl
  • whisk
  • wooden spoon
  • broiler-safe skillet or baking dish
  • broiler

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.