Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chewy Oatmeal Raisin Cookies

Soft, chewy cookies loaded with oats and raisins, baked on a single sheet pan in under 25 minutes. Perfect for lunchboxes, snacking, or a quick homemade treat.

Total time
25 min
Servings
12
Calories
215
Protein
3g
Chewy Oatmeal Raisin Cookies
comfortsimpleamericanvegetarianvegetarianchewysoftDessert

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Set the oven to 350°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. Step 2

    Place the softened butter and brown sugar in a large bowl and stir them together with a wooden spoon until smooth and well combined, about 1 minute.

  3. Step 3

    Crack the egg into the butter-sugar mixture and stir until you see no streaks of white, just one unified yellow color, about 30 seconds.

  4. Step 4

    Add the flour to the egg mixture and stir until you see no dry flour streaks remaining, about 1 minute.

  5. Step 5

    Add the oats to the bowl and stir until evenly distributed throughout the dough, about 1 minute.

  6. Step 6

    Add the raisins to the bowl and stir until they are scattered throughout the dough, about 30 seconds.

  7. Step 7

    Scoop the dough onto an ungreased baking sheet using a spoon or cookie scoop, spacing each blob about 2 inches apart, making 12 cookies total.

  8. Step 8

    Place the baking sheet on the middle oven rack and bake for 12 to 14 minutes, until the edges turn golden brown but the centers still look slightly soft.

  9. Step 9

    Remove the baking sheet from the oven and let the cookies cool on the sheet for 5 minutes—they will firm up as they cool.

  10. Step 10

    Slide a spatula under each cookie and transfer it to a plate or wire rack to cool completely, about 10 minutes.

Tools you’ll need

  • oven
  • large mixing bowl
  • wooden spoon
  • baking sheet (9x13 inch or larger)
  • spoon or cookie scoop
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.