Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chicken Parmesan

Crispy-breaded chicken topped with warm marinara and melted mozzarella. Baked until golden and bubbly—ready in under 30 minutes.

Total time
25 min
Servings
2
Calories
412
Protein
38g
Chicken Parmesan
comfortsatisfyingitalianchickencrispytendermeltyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a baking sheet with foil.

  2. Step 2

    Pound chicken to 1/2-inch thickness between plastic wrap using a meat mallet or heavy pan.

  3. Step 3

    Set up three shallow bowls: flour in one, beaten egg in the second, panko mixed with salt and pepper in the third.

  4. Step 4

    Coat each chicken breast in flour, shaking off excess. Dip in egg, then press into panko until fully coated.

  5. Step 5

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, ~90 seconds.

  6. Step 6

    Sear chicken 3 minutes per side without moving until golden brown. Transfer to the prepared baking sheet.

  7. Step 7

    Spoon 2 tbsp marinara over each chicken breast. Top with 3 tbsp mozzarella per piece.

  8. Step 8

    Bake 8 to 10 minutes until cheese melts and edges bubble slightly.

  9. Step 9

    Serve immediately with remaining warm marinara on the side.

Tools you’ll need

  • baking sheet
  • foil
  • meat mallet or heavy skillet
  • plastic wrap
  • three shallow bowls
  • 12-inch skillet
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.