Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chickpea & Quinoa Buddha Bowl

Protein-packed grain bowl with roasted chickpeas, fresh greens, and a bright tahini dressing. Ready in under 25 minutes.

Total time
22 min
Servings
2
Calories
380
Protein
14g
Chickpea & Quinoa Buddha Bowl
healthyfreshsimplemediterraneanvegetarianveganchickpeascrispy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Spread chickpeas on a sheet pan.

  2. Step 2

    Drizzle chickpeas with 1 tbsp olive oil, salt, and pepper. Toss to coat.

  3. Step 3

    Roast chickpeas 15 minutes, shaking halfway. They should be golden and crispy at edges.

  4. Step 4

    Whisk tahini, lemon juice, 2 tbsp warm water, salt, and pepper until smooth and pourable.

  5. Step 5

    Divide quinoa between bowls. Top with spinach, tomatoes, and roasted chickpeas.

  6. Step 6

    Drizzle tahini dressing over the bowl. Serve immediately.

Tools you’ll need

  • sheet pan
  • small bowl
  • whisk
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.