Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chili Crisp Beef Anticuchos

Peruvian grilled beef skewers with a punchy cumin-chili marinade, finished with bright lime and crispy chili oil. Sheet-pan seared and served with charred onions and boiled potatoes.

Total time
25 min
Servings
4
Calories
385
Protein
38g
Chili Crisp Beef Anticuchos
boldsatisfyingperuvianbeefcharredtendercrispyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toss beef cubes with cumin, paprika, chili flakes, vinegar, salt, and pepper in a bowl until coated.

  2. Step 2

    Heat 2 tbsp olive oil in a large skillet over medium-high until shimmering, about 1 minute.

  3. Step 3

    Sear beef in batches without stirring until deeply browned on two sides, 2 minutes per side. Transfer to a plate.

  4. Step 4

    Add onion wedges to the skillet and char until edges blacken and they soften, 3–4 minutes, stirring halfway.

  5. Step 5

    Return beef to the skillet, squeeze lime juice over everything, and toss to coat.

  6. Step 6

    Drizzle with chili crisp and serve hot with lime wedges and fleur de sel on the side.

Tools you’ll need

  • large bowl
  • large cast-iron skillet or heavy 12-inch skillet
  • tongs or metal spatula
  • cutting board and sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.