Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chili Crisp Seafood Noodles

Crispy chili oil coats tender shrimp and squid tossed with chewy egg noodles in under 10 minutes. One pan, one bowl, pure umami.

Total time
12 min
Servings
2
Calories
385
Protein
28g
Chili Crisp Seafood Noodles
quicksatisfyingvietnameseshrimpsquidchewytendercrispy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large skillet over high heat. Add noodles and cook until just al dente, ~4 minutes.

  2. Step 2

    Push noodles to one side. Add shrimp and squid to the empty side; cook without stirring for 2 minutes until shrimp begins to curl.

  3. Step 3

    Toss everything together. Stir in chili crisp and soy sauce until coated; cook 1 more minute until squid turns opaque.

  4. Step 4

    Divide between bowls. Top with scallions and a drizzle of extra chili crisp oil. Serve hot.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or tongs
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.