Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chili Oil Chicken (Kou Shui Ji)

Poached chicken dressed in fragrant Sichuan chili oil with numbing peppercorns, garlic, and scallions. Ready in 20 minutes and tastes like a restaurant showstopper.

Total time
20 min
Servings
2
Calories
420
Protein
38g
Chili Oil Chicken (Kou Shui Ji)
casualboldchinesechickentendercrispyweeknightmain-dish

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring salted water to a boil in a pot. Add chicken, reduce heat to low, and poach until cooked through, ~12 minutes.

  2. Step 2

    Transfer chicken to a cutting board. Once cool, slice into 1/4-inch strips and arrange on a serving plate.

  3. Step 3

    Toast Sichuan peppercorns in a dry skillet over medium heat for 1 minute until fragrant. Transfer to a small bowl.

  4. Step 4

    Heat oil in the same skillet over medium. Add chili flakes and toast for 30 seconds until the oil turns deep red.

  5. Step 5

    Pour hot oil over garlic and scallions in a bowl. Stir in soy sauce and toasted peppercorns.

  6. Step 6

    Drizzle chili oil and peppercorns over sliced chicken. Serve immediately while oil is still warm.

Tools you’ll need

  • pot (3-quart minimum)
  • cutting board
  • chef's knife
  • 12-inch skillet
  • small bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.